Peptides

High Purity 99% Cosmetic Peptides Foxo4-Dri for Treatment of Rejuvenation by Therapeutic Elimination of Senescent Cells

Item No.: 00172
Description Product List Our Service and Policy Order Procedure Review
Description
Name FOXO4 DRI
CAS N/A
Grade Standard Injection grade
COA Pls contact with Senwayer freely
MOQ 10mg
Appearance White powder
Purity, % (by RP-HPLC) 99%

Product Description

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

Function & Application

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice

Product List

SARMs Raw Powder List:

No.

Product name

CAS No.

Specification

1

Ostarine(MK-2866)

841205-47-8

99%min

2

LGD-4033

1165910-22-4

98%min

3

MK-677

159633-92-8

98%min

4

Andarine(S-4)

401900-40-17

98%min

5

GW 501516

317318-70-0

98%min

6

AICAR

2627-69-2

98%min

7

RAD140

1182367-47-0

98%min

8

SR9009

1379686-30-2

98%min

9

YK11

1370003-76-1

98%min

 

Our Service and Policy

QualityControl

All products are strictly tested by our QC & QA, Approved by third party Lab.

Payment Terms

We can only accept Bank Transfer, Western Union and Money Gram and BitCoin.
Sorry for the inconvenience but Credit card or Paypal or cash on delivery is not available

Sample Policy

For some steroids like test e we can provide 10g sample. Meanwhile, you need to pay the shipping cost.

Shipping Cost

We recomanmand the package weights 100g, 500g and 1Kg due to the method of delivery.Seperate package delivery for order more than 2Kg.
General:
10g-100g: USD45
100g-500g: USD50
500g-1000g: USD55
1000g-2000g: USD60

Resend Policy

If the parcel is seized/lost/damaged and you receive seizure letter from authority, we will resend the same product for free immediately after receiving the seizure letter. We care your business plan and we will never disappoint you.

 

Order Procedure

How to Complete an Order:

Make an order

1.Please let me know the product names, quantity, and the destination country;

2.You confirm all details, and send us purchasing order;

3.We send the detail price of our product and offer the suitable shipping method;

4.You confirm the order and pay money 100% in advance and send the address.

5.We arrange the shipment according to your requirements.

6.We offer after-sales service after you receive parcel.

Shipping

Provide receiver’s addressee info

Packing

According to different countries and quantity of orders

Lead Time

Arranged within 24 hours upon receipt of your payment

Photos

Photos of parcel would be offered to tell apart the goods in advance

Delivery Time

Usually 4-6 working days to reach destinations

Tracking Number

Offered once it is released online.

After-sale Service

24/7 online for problems and concern

 

Review
Review

1/3
X
Send your message to us
please select your country
  • Afghanistan
  • Aland Islands
  • Albania
  • Algeria
  • American Samoa
  • Andorra
  • Angola
  • Anguilla
  • Antigua and Barbuda
  • Argentina
  • Armenia
  • Aruba
  • Australia
  • Austria
  • Azerbaijan
  • Bahamas
  • Bahrain
  • Bangladesh
  • Barbados
  • Belarus
  • Belgium
  • Belize
  • Benin
  • Bermuda
  • Bhutan
  • Bolivia
  • Bosnia and Herzegovina
  • Botswana
  • Bouvet Island
  • Brazil
  • British Indian Ocean Territory
  • British Virgin Islands
  • Brunei Darussalam
  • Bulgaria
  • Burkina Faso
  • Burundi
  • Cambodia
  • Cameroon
  • Canada
  • Cape Verde
  • Caribbean Netherlands
  • Cayman Islands
  • Central African Republic
  • Chad
  • Chile
  • Christmas Island
  • Cocos Islands
  • Colombia
  • Comoros
  • Congo
  • Cook Islands
  • Costa Rica
  • Cote D'ivoire
  • Cuba
  • Curaçao
  • Cyprus
  • Czech Republic
  • Democratic People's Republic of Korea
  • Democratic Republic of the Congo
  • Denmark
  • Djibouti
  • Dominica
  • East Timor
  • Ecuador
  • Egypt
  • El Salvador
  • Equatorial Guinea
  • Eritrea
  • Estonia
  • Ethiopia
  • Falkland Islands
  • Faroe Islands
  • Fiji
  • Finland
  • France
  • French Guiana
  • French Polynesia
  • French Southern Territories
  • Gabon
  • Gambia
  • Georgia
  • Germany
  • Ghana
  • Gibraltar
  • Greece
  • Greenland
  • Grenada
  • Guadeloupe
  • Guam
  • Guatemala
  • Guernsey
  • Guinea
  • Guinea-Bissau
  • Guyana
  • Haiti
  • Heard Island and Mcdonald Islands
  • Honduras
  • Hong Kong, China
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Iran
  • Iraq
  • Ireland
  • Isle of Man
  • Israel
  • Italy
  • Jamaica
  • Japan
  • Jordan
  • Kazakhstan
  • Kenya
  • Kiribati
  • Korea
  • Kosovo
  • Kuwait
  • Kyrgyzstan
  • Laos
  • Latvia
  • Lebanon
  • Lesotho
  • Liberia
  • Liechtenstein
  • Lithuania
  • Luxembourg
  • Macau, China
  • Macedonia
  • Madagascar
  • Malawi
  • Malaysia
  • Maldives
  • Mali
  • Malta
  • Marshall Islands
  • Martinique
  • Mauritania
  • Mauritius
  • Mayotte
  • Mexico
  • Micronesia
  • Moldova
  • Monaco
  • Mongolia
  • Montenegro
  • Montserrat
  • Morocco
  • Mozambique
  • Myanmar
  • Namibia
  • Nauru
  • Nepal
  • Netherlands
  • Netherlands Antilles
  • New Caledonia
  • New Zealand
  • Nicaragua
  • Niger
  • Nigeria
  • Niue
  • Norfolk Island
  • Northern Mariana Islands
  • Norway
  • Oman
  • Pakistan
  • Palau
  • Palestine
  • Panama
  • Papua New Guinea
  • Paraguay
  • Peru
  • Philippines
  • Pitcairn Islands
  • Poland
  • Portugal
  • Puerto Rico
  • Qatar
  • Reunion
  • Romania
  • Russia
  • Rwanda
  • Saint Barthélemy
  • Saint Helena
  • Saint Kitts and Nevis
  • Saint Lucia
  • Saint Martin
  • Saint Pierre and Miquelon
  • Saint Vincent and the Grenadines
  • San Marino
  • Sao Tome and Principe
  • Saudi Arabia
  • Senegal
  • Serbia
  • Seychelles
  • Sierra Leone
  • Singapore
  • Sint Maarten
  • Slovakia
  • Slovenia
  • Solomon Islands
  • Somalia
  • South Africa
  • South Georgia and The South Sandwich Islands
  • Spain
  • Sri Lanka
  • State of Libya
  • Sudan
  • Suriname
  • Svalbard and Jan Mayen
  • Swaziland
  • Sweden
  • Switzerland
  • Syrian Arab Republic
  • TaiWan, China
  • Tajikistan
  • Tanzania
  • Thailand
  • The Republic of Croatia
  • Togo
  • Tokelau
  • Tonga
  • Trinidad and Tobago
  • Tunisia
  • Turkey
  • Turkmenistan
  • Turks and Caicos Islands
  • Tuvalu
  • Uganda
  • Ukraine
  • United Arab Emirates
  • United Kingdom
  • United States
  • United States Minor Outlying Islands
  • Uruguay
  • US Virgin Islands
  • Uzbekistan
  • Vanuatu
  • Vatican City State
  • Venezuela
  • Vietnam
  • Wallis and Futuna Islands
  • Western Sahara
  • Western Samoa
  • Yemen
  • Zambia
  • Zimbabwe
Subscribe To Get The Latest Brochures And Quotations
Please leave your email address. We wil regularly send the latest catalog and quotation to your email.