High Purity 99% FOXO4-DRI Peptide for Skin Rejuvenation
Unlock the potential of 99% pure FOXO4-DRI peptide, a premium cosmetic ingredient designed to rejuvenate skin by targeting and eliminating senescent cells. Perfect for use in advanced skincare formulations, this high-purity peptide offers a powerful, non-invasive approach to achieving youthful, radiant skin.
Therapeutic Benefits of FOXO4-DRI in Anti-Aging Skincare
FOXO4-DRI peptide is renowned for its ability to neutralize senescent cells, a key contributor to visible aging. By incorporating this high-purity peptide, skincare products can provide clients with smoother skin texture, improved elasticity, and a reduction in age-related signs. Ideal for custom cosmetic applications and bulk orders, FOXO4-DRI is a cornerstone for any advanced anti-aging skincare line.
| Name | FOXO4 DRI |
| CAS | N/A |
| Grade Standard | Injection grade |
| COA | Pls contact with Senwayer freely |
| MOQ | 10mg |
| Appearance | White powder |
| Purity, % (by RP-HPLC) | 99% |
Product Description
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
Function & Application
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice
Product Advantages
Promotes Skin Rejuvenation - FOXO4-DRI peptide effectively supports skin renewal by eliminating senescent cells, leading to healthier and more youthful-looking skin.
High Purity for Maximum Effectiveness - With a 99% purity level, this peptide ensures potent, reliable results, ideal for therapeutic and cosmetic applications.
Customizable and Bulk-Friendly - Suited for custom skincare formulations and available in bulk, making it perfect for brands and businesses in the skincare industry.
Non-Invasive Anti-Aging Solution - Provides a safe and effective alternative to invasive treatments, aligning with consumer demand for natural rejuvenation options.
FAQ
Who are we?
We are INNO, a company specializing in high-quality cosmetic peptides focused on advanced skincare and rejuvenation solutions.
How can we guarantee quality?
We guarantee quality through rigorous testing, high-purity standards, and sourcing premium ingredients, ensuring every batch meets industry standards.
What can you buy from us?
You can buy a variety of high-purity cosmetic peptides ideal for anti-aging, skin rejuvenation, and custom skincare formulations.
Why should you buy from us and not from other suppliers?
Our commitment to quality, innovation, and tailored solutions makes us a trusted partner for premium peptides in custom and bulk orders.
What services can we provide?
We offer custom formulation support, bulk ordering options, and dedicated customer service to meet diverse skincare and cosmetic industry needs.
At INNO, our journey began with a vision to revolutionize skincare through advanced peptide technology. Founded by a team of passionate scientists and skincare experts, we set out to harness the power of high-purity peptides to address some of the most persistent challenges in anti-aging and skin rejuvenation. Driven by a commitment to quality, research, and innovation, InnoPeptides has dedicated years to refining our processes and sourcing the highest-quality ingredients, ensuring each product meets the rigorous standards of our clients and the skincare industry.
Our mission is to empower brands, formulators, and skincare professionals with groundbreaking peptide solutions that unlock the potential for true rejuvenation and healing. Specializing in custom and bulk formulations, InnoPeptides provides the foundation for creating transformative products tailored to meet diverse skincare needs. As we continue to grow, our dedication to pushing the boundaries of peptide science remains unwavering—because at INNO, we believe that science-driven skincare is the future of beauty and wellness.
SARMs Raw Powder List:
|
No. |
Product name |
CAS No. |
Specification |
|
1 |
Ostarine(MK-2866) |
841205-47-8 |
99%min |
|
2 |
LGD-4033 |
1165910-22-4 |
98%min |
|
3 |
MK-677 |
159633-92-8 |
98%min |
|
4 |
Andarine(S-4) |
401900-40-17 |
98%min |
|
5 |
GW 501516 |
317318-70-0 |
98%min |
|
6 |
AICAR |
2627-69-2 |
98%min |
|
7 |
RAD140 |
1182367-47-0 |
98%min |
|
8 |
SR9009 |
1379686-30-2 |
98%min |
|
9 |
YK11 |
1370003-76-1 |
98%min |
|
QualityControl |
All products are strictly tested by our QC & QA, Approved by third party Lab. |
|
Payment Terms |
We can only accept Bank Transfer, Western Union and Money Gram and BitCoin. |
|
Sample Policy |
For some steroids like test e we can provide 10g sample. Meanwhile, you need to pay the shipping cost. |
|
Shipping Cost |
We recomanmand the package weights 100g, 500g and 1Kg due to the method of delivery.Seperate package delivery for order more than 2Kg. |
|
Resend Policy |
If the parcel is seized/lost/damaged and you receive seizure letter from authority, we will resend the same product for free immediately after receiving the seizure letter. We care your business plan and we will never disappoint you. |
How to Complete an Order:
|
Make an order |
1.Please let me know the product names, quantity, and the destination country; |
|
2.You confirm all details, and send us purchasing order; |
|
|
3.We send the detail price of our product and offer the suitable shipping method; |
|
|
4.You confirm the order and pay money 100% in advance and send the address. |
|
|
5.We arrange the shipment according to your requirements. |
|
|
6.We offer after-sales service after you receive parcel. |
|
|
Shipping |
Provide receiver’s addressee info |
|
Packing |
According to different countries and quantity of orders |
|
Lead Time |
Arranged within 24 hours upon receipt of your payment |
|
Photos |
Photos of parcel would be offered to tell apart the goods in advance |
|
Delivery Time |
Usually 4-6 working days to reach destinations |
|
Tracking Number |
Offered once it is released online. |
|
After-sale Service |
24/7 online for problems and concern |
