Name | FOXO4 DRI |
CAS | N/A |
Grade Standard | Injection grade |
COA | Pls contact with Senwayer freely |
MOQ | 10mg |
Appearance | White powder |
Purity, % (by RP-HPLC) | 99% |
Product Description
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
Function & Application
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice
SARMs Raw Powder List:
No. |
Product name |
CAS No. |
Specification |
1 |
Ostarine(MK-2866) |
841205-47-8 |
99%min |
2 |
LGD-4033 |
1165910-22-4 |
98%min |
3 |
MK-677 |
159633-92-8 |
98%min |
4 |
Andarine(S-4) |
401900-40-17 |
98%min |
5 |
GW 501516 |
317318-70-0 |
98%min |
6 |
AICAR |
2627-69-2 |
98%min |
7 |
RAD140 |
1182367-47-0 |
98%min |
8 |
SR9009 |
1379686-30-2 |
98%min |
9 |
YK11 |
1370003-76-1 |
98%min |
QualityControl |
All products are strictly tested by our QC & QA, Approved by third party Lab. |
Payment Terms |
We can only accept Bank Transfer, Western Union and Money Gram and BitCoin. |
Sample Policy |
For some steroids like test e we can provide 10g sample. Meanwhile, you need to pay the shipping cost. |
Shipping Cost |
We recomanmand the package weights 100g, 500g and 1Kg due to the method of delivery.Seperate package delivery for order more than 2Kg. |
Resend Policy |
If the parcel is seized/lost/damaged and you receive seizure letter from authority, we will resend the same product for free immediately after receiving the seizure letter. We care your business plan and we will never disappoint you. |
How to Complete an Order:
Make an order |
1.Please let me know the product names, quantity, and the destination country; |
2.You confirm all details, and send us purchasing order; |
|
3.We send the detail price of our product and offer the suitable shipping method; |
|
4.You confirm the order and pay money 100% in advance and send the address. |
|
5.We arrange the shipment according to your requirements. |
|
6.We offer after-sales service after you receive parcel. |
|
Shipping |
Provide receiver’s addressee info |
Packing |
According to different countries and quantity of orders |
Lead Time |
Arranged within 24 hours upon receipt of your payment |
Photos |
Photos of parcel would be offered to tell apart the goods in advance |
Delivery Time |
Usually 4-6 working days to reach destinations |
Tracking Number |
Offered once it is released online. |
After-sale Service |
24/7 online for problems and concern |